Sign In | Join Free | My
Biopro Chemicals Co., Ltd.
Biopro Chemicals Co., Ltd. Growth Hormone Peptides, Anabolic Steroid Chemicals, Natural Bodybuilding Supplements Delivering Safe & Success.
Home > Growth Hormone Peptides >

GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial

Biopro Chemicals Co., Ltd.
Trust Seal
Verified Supplier
Credit Check
Supplier Assessment

GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial

GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial

GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial Basic Info. Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 7,372 Da ...

Send your message to this supplier
Enter your email please.
To: Biopro Chemicals Co., Ltd.
Characters Remaining: (0/3000)